PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000809452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 387aa    MW: 43797.9 Da    PI: 6.506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000809452genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
    MDP0000809452 14 KGPWSPEEDARLKAYIEEHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.36.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
    MDP0000809452  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.976962IPR017930Myb domain
SuperFamilySSF466891.59E-2611109IPR009057Homeodomain-like
SMARTSM007177.6E-131364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241569IPR009057Homeodomain-like
CDDcd001672.73E-91662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.5E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2370117IPR009057Homeodomain-like
CDDcd001671.00E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDARLKAYIE EHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGM  120
RKQSNINRSP LDQSQDHQLK DADDAQALSS STLERLQLHM QLQSLQNPFS FYNHPALWPK  180
LHPLQEKMIQ TLRSMNDNNP MMHHHAPTTP LQPAQGQKGN INDVYEQVQP TSASILIQEE  240
YAKLCNKKNM DELENPLNGM SSSDTRYHAF ISTSNQVDST IVAAKADNVE QSNSVGSHDP  300
HHQVNLSFHG EFGDTDNNKC VGFTAQQEHD QMAEFDCFKE MNVSKDSLVW WANEFDAKSA  360
SSDSWDSTSI LHSQGMFQDY ELGYNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-23141177108B-MYB
1h8a_C9e-231411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341179.10.0PREDICTED: transcription factor RAX3
TrEMBLM5XIY10.0M5XIY1_PRUPE; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-103myb domain protein 36